Figure 3 of Baer, Mol Vis 4:30, 1998.


Figure 3. Confirmation of Arg1005->Gln substitution by liquid chromatography tandem mass spectrometry

This figure shows the amino acid sequence of the Arg1005->Gln thioredoxin fusion protein mutant. The exclamation mark (!) denotes the end of the thioredoxin fusion protein. The blue regions indicate the tryptic fragments that were identified by their mass to charge ratio. The amino acid sequences of these tryptic fragments were confirmed by collision-activated dissociation mass spectrometry. The asterisks (*) denote the location of the four arginines that were mutated: (Arg1005, Arg1041, Arg1073, and Arg1122). The underlined regions are highly conserved between the carboxy-terminal modules of IRBPs and CtpAs [48].


MSDKIIHLTDDSFDTDVLLADGAILVDFWAHWCGPCKMIAPILDEIADEYQGKLTVAKLNIDHNPGTAPKYGIRGIPTLL


                                                         !
LFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGDDDDKVPMHELEIFEFRGRRGDPTKIPTVIQTAAKLVADNYAFADT



GANVASKFIALVDKIDYKMIKSEVELAEKINDDLQSLSKDFHLKAVYIPENSKDRIPGVVPMQIPSPELFEELIKFSFHT


          *                                   *                                *
DVFEKNIGYIQFDMFADSDLLNQVSDLLVEHVWKKVVDQDALIIDMRFNIGGPTSSIPIFCSYFFDEGTPVLLDKIYSRT
      ---------                           ----------

                                               *
SNAMTDIWTLPDLVGKTFGSKKPLIILTSSLTEGAAEEFVYIMKRLGRAYVVGEVTSGGCHPPQTYHVDDTHLYLTIPTS
                                              ------------


RSASAEPGESWEGKGVLPDLEISSETALLKAKEILESQLEGRR

Baer, Mol Vis 1998; 4:30 <http://www.molvis.org/molvis/v4/p30>
©1998 Molecular Vision <http://www.molvis.org/molvis/>
ISSN 1090-0535